PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00019623-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 160aa    MW: 18828.4 Da    PI: 4.6991
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00019623-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.63.2e-0981119444
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                       +++eE++l+++  k+ G++ W++Ia +++ gR ++++  +w
  PSME_00019623-RA  81 MSEEEEDLILRMYKLIGNK-WSLIAGRIP-GRKEEEIERYW 119
                       69*****************.*********.**********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.001777125IPR001005SANT/Myb domain
PfamPF002492.0E-881120IPR001005SANT/Myb domain
CDDcd001672.56E-681119No hitNo description
Gene3DG3DSA:1.10.10.607.6E-1282119IPR009057Homeodomain-like
PROSITE profilePS500906.73782119IPR017877Myb-like domain
SuperFamilySSF466892.73E-782124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MQFLIEQWRD HLPPGYLLKK ASIDTPFEED ACRCHFVFVK DRNVYDEAEL ALRLQWFIGE  60
KTPTKFEIIK EGSSLDWECD MSEEEEDLIL RMYKLIGNKW SLIAGRIPGR KEEEIERYWA  120
MRTQQFCDSH GATIFASNKQ MGNMISIPYH INGCNDVEVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.15e-22MYB_related family protein